The tesamorelin peptide is a synthetic 44-amino-acid analogue of human growth hormone-releasing hormone (GHRH), modified at the N-terminus with a trans-3-hexenoyl group to resist enzymatic degradation. Laboratory studies use it to examine GHRH receptor signalling, the regulation of growth hormone secretion and the pharmacology of dipeptidyl peptidase IV (DPP-IV) resistance in cell lines and animal models. This article summarises its structure, mechanism, the published research areas and the analytical and storage standards that support reproducible work. It is written for laboratory researchers and offers no guidance on human use.
Comparing GHRH analogues? See our plain-English guide to sermorelin vs tesamorelin and how the two peptides differ.
What is tesamorelin peptide?
Tesamorelin is classified as a synthetic GHRH analogue. Its backbone is the full-length human GHRH(1-44) amide, whose sequence is YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2. The single structural modification is a trans-3-hexenoyl group attached to the amino group of the N-terminal tyrosine. The molecular formula is approximately C221H366N72O67S, and the molecular weight is about 5136 Da, which makes it a considerably larger peptide than many commonly supplied research materials.
The reason for the modification lies in the biology of the native hormone. Native GHRH is cleaved within minutes in plasma by DPP-IV, which removes the first two residues, Tyr-Ala, and leaves a biologically inactive fragment. Early work by Frohman and colleagues in the 1980s described this rapid enzymatic degradation. Capping the N-terminus with the hexenoyl group sterically hinders DPP-IV, which prolongs the molecule’s persistence in biological systems relative to the native sequence while preserving receptor activity.
GHRH itself was isolated in 1982, when groups led by Roger Guillemin and by Wylie Vale and Jean Rivier characterised it from pancreatic tumours associated with excess growth hormone secretion. Guillemin shared the 1977 Nobel Prize in Physiology or Medicine with Andrew Schally for work on hypothalamic hormones. The tesamorelin analogue was developed by Theratechnologies, and a pharmaceutical formulation has been authorised in the United States for a specific clinical indication. This article does not discuss clinical use, and research-grade material is not equivalent to a licensed pharmaceutical product. To the author’s understanding, tesamorelin is not authorised as a medicine in the United Kingdom, and its status should be checked against current Medicines and Healthcare products Regulatory Agency (MHRA) records.
One practical point for buyers: the molecule is large enough that synthesis, purification and characterisation are more demanding than for short peptides. A batch described as the tesamorelin peptide should be verified by mass spectrometry for both the 44-residue backbone and the N-terminal modification, because the unmodified GHRH(1-44) sequence is a different, far less stable compound with a mass lower by about 98 Da.
Mechanism of action
Tesamorelin acts as an agonist at the GHRH receptor (GHRH-R), a class B G protein-coupled receptor expressed predominantly on somatotroph cells of the anterior pituitary. The peptide binds through contacts between its N-terminal region and the receptor’s transmembrane core, and between its C-terminal portion and the large extracellular domain. This two-site engagement is typical of class B receptors and explains why the full 44-residue sequence is retained in the analogue, although the first 29 residues carry most of the intrinsic activity.
Receptor binding activates the stimulatory G protein, Gs, which stimulates adenylyl cyclase and raises intracellular cyclic AMP (cAMP). Protein kinase A is then activated, and downstream phosphorylation of transcription factors including CREB promotes expression of the growth hormone gene and the pituitary transcription factor Pit-1. The same pathway increases the exocytosis of stored growth hormone from secretory granules. In an intact animal, the released growth hormone acts on peripheral tissues, notably the liver, to stimulate production of insulin-like growth factor 1 (IGF-1), and the axis is controlled by negative feedback from IGF-1 and by somatostatin.
In cell-based work, the mechanism is usually tested in cells expressing the receptor, such as transfected HEK293 or CHO lines or primary pituitary cultures. Readouts include cAMP accumulation, cAMP-response element reporter assays and growth hormone released into the medium, from which concentration-response curves are built and EC50 values compared between analogues. In these systems, “dosage” means molar concentration in the medium. That value depends on net peptide content, on adsorption of a relatively large peptide to plasticware and on protease activity in any serum used, which is why handling and verification are inseparable from the pharmacology.
A final mechanistic point concerns selectivity. Because the receptor is class B and the analogue is a full-length GHRH, activity is expected to be selective for GHRH-R over related family members such as the VPAC and PACAP receptors, but this should be tested and reported, not assumed, in any new assay system.
What the research shows
The literature relevant to the tesamorelin peptide spans receptor biology, peptide chemistry and animal and clinical pharmacology. Four areas are summarised below in general terms. Readers should consult the primary papers for methods, concentrations and statistics, because commercial summaries frequently overstate findings.
The first area is the discovery and characterisation of GHRH. The 1982 isolation papers described the structure of the human hormone from tumour tissue and showed that synthetic peptides based on the sequence stimulated growth hormone release from cultured pituitary cells. Researchers interested in the original chemistry can begin with a PubMed search for the 1982 GHRH isolation and characterisation papers.
The second area is the enzymatic inactivation of GHRH. Work published in the 1980s examined the fate of the native peptide in plasma and identified cleavage at the N-terminus as the main route of inactivation, which later led to the DPP-IV understanding described above. These studies used plasma incubations and analytical separation of fragments, and they supplied the rationale for N-terminal modification in analogue design. They can be explored through a PubMed search for the rapid enzymatic degradation of GHRH in plasma.
The third area is genetic and animal models of the GHRH axis. Studies in the little (lit/lit) mouse, which carries a mutation in the GHRH receptor gene, showed that a functional receptor is required for normal somatotroph development and growth hormone secretion, which established the receptor as the essential target of GHRH signalling. Other rodent studies have used GHRH analogues to examine pulsatility, feedback and the response of the pituitary to continuous versus intermittent stimulation. These are controlled experiments carried out under ethical approval, with exposures expressed per kilogram of body weight, and the values differ widely with route and model. They should be taken directly from the primary papers.
The fourth area is clinical pharmacology, which exists because a pharmaceutical formulation has been developed. Trials conducted under regulatory oversight in specific patient populations are part of the scientific record. They are mentioned here only for completeness. They were conducted under medical supervision with a licensed formulation, they say nothing about research-grade material, and nothing in this article should be read as describing a use for the compound outside such a setting.
A recurring limitation runs through this body of work. Most of the native GHRH literature predates the analogue, assay systems vary between laboratories, and the exact material used, including the extent of the N-terminal modification, is not always characterised. Reproducibility therefore depends heavily on knowing what was actually in the vial.
Research applications
In the laboratory, the tesamorelin peptide is used in several contexts. The most common is as a reference agonist in GHRH receptor pharmacology, where it is used to characterise signalling, benchmark novel agonists and antagonists and validate cAMP and reporter assays. Its resistance to DPP-IV makes it convenient in assays that run for hours in the presence of serum or plasma-derived components.
A second context is the study of peptide stabilisation. N-terminal modification to block exopeptidase cleavage is a well-known strategy, and tesamorelin is a standard example in discussions of how a small chemical cap alters half-life without disrupting receptor engagement. Researchers developing other modified peptides sometimes use it as a comparator, and DPP-IV inhibition and degradation assays use GHRH analogues as substrates.
A third context is neuroendocrine physiology in animal models, where analogues are used to probe the dynamics of the growth hormone axis, the role of somatostatin tone and the interaction between pulsatile and tonic stimulation. These experiments require institutional ethical review and, in the United Kingdom, authorisation under the Animals (Scientific Procedures) Act 1986.
A fourth context is analytical and anti-doping science. GHRH and its analogues, including tesamorelin, appear on the World Anti-Doping Agency prohibited list, and reference samples of defined identity and purity are used to develop and validate liquid chromatography and mass spectrometry methods for their detection. For this purpose, accurate mass, confirmed modification and quantified purity are essential, because the method is only as reliable as the reference material.
Across all these applications, the sensible meaning of exposure is a defined concentration or per-kilogram quantity, justified by prior literature and verified by analytical characterisation of the material actually used.
Purity, storage and handling
A 44-residue peptide is among the more difficult targets for solid-phase synthesis. Across that many coupling steps, small per-step inefficiencies compound, so the crude product contains truncated and deletion sequences, racemised products and adducts from protecting groups, and the N-terminal acylation adds a further step that may be incomplete. Reversed-phase high-performance liquid chromatography (HPLC) with UV detection at 214 or 220 nm is the standard method for purity, and receptor pharmacology work generally looks for a main peak of at least 98 per cent. For a molecule of this size, a shallow gradient is needed to resolve closely related impurities, and a stated percentage is meaningful only if the method and chromatogram are available.
HPLC should always be paired with mass spectrometry. For this compound the expected mass is about 5136 Da, and the instrument should show that the modified peptide is the dominant species. A peak at about 5038 Da would indicate the unmodified GHRH(1-44) sequence, a different and less stable compound. The methionine at position 27 is susceptible to oxidation, which adds 16 Da, so the mass spectrum is also a useful check on storage history.
A batch-specific certificate of analysis matters because purity, peptide content and the degree of N-terminal modification can all vary between synthesis runs. The certificate should carry a lot number matching the vial, the HPLC trace or purity value, the observed and theoretical masses, the test date and, ideally, the salt form and net peptide content. Lyophilised powders contain counterions and residual water, so the weighed mass is not the mass of peptide, and ignoring this introduces systematic errors into any concentration-response comparison.
Because a large peptide degrades faster once in solution, and because the methionine and asparagine residues are vulnerable to oxidation and deamidation, batch-level verification matters more here than with short, robust peptides. Laboratories comparing peptides uk sources for this 44-residue analogue should expect a batch-specific certificate of analysis showing mass confirmation of the modified peptide and lyophilised storage at -20°C, and the same documentation standard applies when weighing any best peptides supplier uk claim, since a supplier’s analytical record rather than its search ranking shows whether the vial matches its stated specification.
Lyophilised tesamorelin peptide is generally stored at -20°C in a sealed container with desiccant, and many laboratories use -80°C for long-term archives. Vials should reach room temperature before opening so that condensation does not form on the cold powder. After reconstitution, stability falls. Standard practice is to dissolve the peptide in sterile water or a suitable buffer, divide the solution into single-use aliquots and freeze them to avoid repeated freeze-thaw cycles. Refrigerated storage at 2 to 8°C is sometimes used for solutions consumed within days, but the acceptable period should be validated for the assay concerned, preferably by re-running HPLC and mass spectrometry on stored solution. Neutral to alkaline pH can accelerate deamidation, and a peptide of this length can aggregate at high concentration, so working stocks should be prepared at the lowest practical concentration.
Light sensitivity is a secondary but genuine concern. The tyrosine, phenylalanine and methionine residues can undergo photo-oxidation, so amber vials or dark storage are advisable, and prolonged exposure to bright laboratory lighting should be avoided. Peptides of this size also adsorb to glass and some plastics at low concentrations, so low-bind tubes are preferred for dilute working solutions.
Labelling is a final indicator of quality. Clear naming, sequence, molecular weight, lot number, salt form and an unambiguous research-only statement suggest a supplier that understands its market. Wording that implies use in humans is a warning sign and raises regulatory concerns in the United Kingdom.
Frequently asked questions
What is tesamorelin peptide used for in laboratory research?
It is used as a reference GHRH receptor agonist in cell-based pharmacology, in studies of peptide stabilisation and in approved animal work on the growth hormone axis. It is also used as a reference material in anti-doping analytical methods. It is a research material and not a licensed medicine.
What is the difference between tesamorelin and native GHRH?
Native GHRH(1-44) is rapidly cleaved by DPP-IV in plasma. Tesamorelin carries a trans-3-hexenoyl group on the N-terminal tyrosine that blocks this cleavage, giving it a molecular weight of about 5136 Da. Results from one compound should not be applied to the other without checking the certificate of analysis.
How should tesamorelin peptide be stored for research?
Keep lyophilised peptide at -20°C, or -80°C for long-term archiving, in a sealed, dry, light-protected container. Allow vials to reach room temperature before opening. After reconstitution, aliquot and freeze the solution to avoid repeated freeze-thaw cycles and prolonged storage in solution.
How can I verify the quality of a tesamorelin peptide batch?
Request a batch-specific certificate showing HPLC purity and a mass spectrometry result near 5136 Da, confirming the N-terminal modification, with a lot number matching the vial. For critical work, independent testing by an accredited analytical laboratory confirms identity, purity and net peptide content.
The tesamorelin peptide described in this article is supplied for in-vitro laboratory research only and is not intended for human or veterinary use.
